PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0352409.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 300aa    MW: 34763.5 Da    PI: 8.9038
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0352409.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.44.1e-51231512128
              NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                       pGfrFhPtdeelv +yLk+kv +k+l++ + ik+vdiyk++PwdLpk  + ++kewyfF+kr +ky+++ r+nr+tksg+Wkatg dk ++s 
  Lj0g3v0352409.1  23 LPGFRFHPTDEELVGFYLKRKVGKKPLRI-DLIKQVDIYKYDPWDLPKVNSVGDKEWYFFCKRGRKYRNSIRPNRVTKSGFWKATGIDKVIYSV 115
                      69***************************.99***************7666799*************************************998 PP

              NAM  96 ...kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++ +glkk+Lv+y+g+a kg+ktdW+mhe+rl
  Lj0g3v0352409.1 116 kepHHQSIGLKKSLVYYRGSAGKGTKTDWMMHEFRL 151
                      7888889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-5615178IPR003441NAC domain
PROSITE profilePS5100553.82322179IPR003441NAC domain
PfamPF023654.1E-2624151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MDVVQLHTLS ETDDKMKEEE VVLPGFRFHP TDEELVGFYL KRKVGKKPLR IDLIKQVDIY  60
KYDPWDLPKV NSVGDKEWYF FCKRGRKYRN SIRPNRVTKS GFWKATGIDK VIYSVKEPHH  120
QSIGLKKSLV YYRGSAGKGT KTDWMMHEFR LPPNNPHDAN ASNDVQEAEV WTLCRIFKRI  180
TPYKKYTPNL KDSAADTKPN PETSIDSDNC KSFMQQVEMK PIFGFVDQNK QLLLGQFGSV  240
ALPGVPSTLP YPSSWNQNIV EDTIFANQNW DDLRSAIQFA NDPSKVYDNF IETYIPPYFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A6e-492418522174NAC domain-containing protein 19
3swm_B6e-492418522174NAC domain-containing protein 19
3swm_C6e-492418522174NAC domain-containing protein 19
3swm_D6e-492418522174NAC domain-containing protein 19
3swp_A6e-492418522174NAC domain-containing protein 19
3swp_B6e-492418522174NAC domain-containing protein 19
3swp_C6e-492418522174NAC domain-containing protein 19
3swp_D6e-492418522174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003551931.11e-154PREDICTED: transcription factor JUNGBRUNNEN 1
SwissprotQ9SK551e-85NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLA0A0R0EYY21e-154A0A0R0EYY2_SOYBN; Uncharacterized protein
STRINGGLYMA18G13574.11e-154(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101334112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.16e-87NAC domain containing protein 42